General Information

  • ID:  hor005346
  • Uniprot ID:  P83230
  • Protein name:  Peptide TNP-c
  • Gene name:  NA
  • Organism:  Oxyuranus microlepidotus (Inland taipan) (Diemenia microlepidota)
  • Family:  natriuretic peptide family
  • Source:  animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oxyuranus (genus), Acanthophiinae (subfamily), Elapidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SDSKIGNGCFGFPLDRIGSVSGLGCNRIMQNPPKKFSGE
  • Length:  39
  • Propeptide:  SDSKIGNGCFGFPLDRIGSVSGLGCNRIMQNPPKKFSGE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Produces a near complete relaxation in pre-contracted aortae by activating the natriuretic peptide receptor-A (NPR1).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  9-25
  • Structure ID:  AF-P83230-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P83230-F1.pdbhor005346_AF2.pdbhor005346_ESM.pdb

Physical Information

Mass: 479265 Formula: C177H282N52O55S3
Absent amino acids: AHTWY Common amino acids: G
pI: 8.81 Basic residues: 5
Polar residues: 17 Hydrophobic residues: 9
Hydrophobicity: -41.54 Boman Index: -6413
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 57.44
Instability Index: 981.28 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.29

Literature

  • PubMed ID:  15652496
  • Title:  Novel Natriuretic Peptides From the Venom of the Inland Taipan (Oxyuranus Microlepidotus): Isolation, Chemical and Biological Characterisation.